Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.006G195200_circ_g.1 |
| ID in PlantcircBase | gra_circ_000649 |
| Alias | Chr06:45215862|45217309 |
| Organism | Gossypium raimondii |
| Position | chrChr06: 45215862-45217309 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.006G195200 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.006G195200.2:4 Gorai.006G195200.4:4 Gorai.006G195200.5:4 Gorai.006G195200.3:4 Gorai.006G195200.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.131273596 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
45215890-45215945(+) 45215890-45217223(-) |
| Potential amino acid sequence |
MVSNVPLPTPGKERVLFAIDNCLLSVEVPPKDGLPQADISFQPLVQCLDVDNLIKLFTAVLLER RILIRSNKYSLLTLASEAICHLIYPFRWQHVYIPLLFFSGVDYIDAPTPYMMGLHSGVDTSNLG MDGQAVVGCYCTYGLQCTFAYTWERAGSICY*(+) MCNNIPQRLDRPFQDLMYQHLNEDPSYMVLERQCSLLH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |