Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0149900_circ_g.6 |
| ID in PlantcircBase | osa_circ_010497 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 2454912-2455026 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0149900 |
| Parent gene annotation |
IQ calmodulin-binding region domain containing protein. (Os12t01 49900-01);IQ calmodulin-binding region domain containing protein . (Os12t0149900-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0149900-01:1 Os12t0149900-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.30445 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2454924-2455000(-) |
| Potential amino acid sequence |
MPPRWQALDFARLSHSTVSFFDDPKPETVASRWNRVSLNASKVASVGFRAAEPQHRLLLRRPET GDRSVAMEPRQPQCLQGGKRWISRG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |