Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0115500_circ_g.1 |
| ID in PlantcircBase | osa_circ_029435 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 869224-869344 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0115500 |
| Parent gene annotation |
Similar to 60S ribosomal protein L13 (BBC1 protein homolog). (Os 06t0115500-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0115500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.944713811 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
869311-869256(+) 869334-869343(-) 869306-869338(-) |
| Potential amino acid sequence |
MTLLCFTMAYLTDAAPLLAGGLVEPCLDIVLPVLLEVPIRDDVVVLHHGLPYRCGASACGRAG* (+) MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIGKVSHGEAQQRHPEWALQEALAELCQDM VQPARPQAEAPHR*(-) MGTSRSTGRTMSRHGSTSPPASRGAASVR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |