Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0708100_circ_g.2 |
| ID in PlantcircBase | osa_circ_016175 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 29273838-29274003 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os02g0708100 |
| Parent gene annotation |
Similar to Carbamoyl phosphate synthetase small subunit (EC 6.3. 5.5). (Os02t0708100-01);Similar to Carbamoyl-phosphate synthase small chain. (Os02t0708100-02);Similar to Carbamoyl-phosphate sy nthase small chain. (Os02t0708100-03) |
| Parent gene strand | + |
| Alternative splicing | Os02g0708100_circ_g.3 |
| Support reads | 10 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0708100-02:1 Os02t0708100-01:1 Os02t0708100-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.123995984 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29273941-29273842(+) 29273990-29273842(+) 29273845-29273937(-) |
| Potential amino acid sequence |
MKLLSLQYHPESSPGPHDSDLEP*(+) MILTWNHNYAVDPESLPEGVKVTHINLNDNSCAGLQYPKMKLLSLQYHPESSPGPHDSDLEP*( +) MVPSQNHAARVRTLDGTEETKVSS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |