Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0307400_circ_g.1 |
| ID in PlantcircBase | osa_circ_027361 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 13945530-13945789 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0307400 |
| Parent gene annotation |
Similar to Regulatory associated protein of mTOR (Raptor) (P150 target of rapamycin (TOR)-scaffold protein). (Os05t0307400-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0307400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.162309006 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13945687-13945641(+) 13945644-13945785(-) 13945579-13945660(-) |
| Potential amino acid sequence |
MGRSLLGGMILWSLEAGFLRILLQPALEDVAVLNPTAGMFALAGMDLTISMRATSAADCSAAFL LENPGREP*(+) MAPCPDSPTERLQNSLLLKLPSWKLSSPYQPTQTSQLLG*(-) MEIVKSIPANANIPAVGLRTATSSRAGCKSMRRKPASRLQSIIPPRRDLPMSLSSSPQW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |