Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc02g091030.2_circ_g.1 |
| ID in PlantcircBase | sly_circ_000825 |
| Alias | SL3.0ch02:53104153|53105601 |
| Organism | Solanum lycopersicum |
| Position | chr2: 52466872-52468320 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI; find_circ |
| Parent gene | Solyc02g091030.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc02g091030.2.1:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.1461688 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
52468260-52466887(+) 52466893-52466919(+) |
| Potential amino acid sequence |
MMSKEINLTWLIVWFSLITFQSKEKT*(+) MPISRIRRAMKSNDQVKMVSATSTVLLSKAIEMLIMDLTLRAWMQADKGKCRTLKRYDFARAIR DEELFDFLSDIVPLQTYKVQKDANDGQGNEPHPAYQVLEPSNIPVEEDANGSQGNEFHPAGQMV QHQKILVEEANDVQGNKFDLANRMVQPHNVPIQRENLRCPFQGSDGL*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to low-temperature stress (acting as miRNA sponges) |
| Other Information | |
|---|---|
| References | Yang et al., 2020 |