Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0277500_circ_g.3 |
| ID in PlantcircBase | osa_circ_011104 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 10295267-10295474 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0277650 |
| Parent gene annotation |
Hypothetical protein. (Os12t0277650-00) |
| Parent gene strand | - |
| Alternative splicing | Os12g0277500_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os12t0277500-02:1 Os12t0277500-01:1 Os12t0277650-00:1 Os12t0277500-02:1 Os12t0277500-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.377465184 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10295413-10295271(+) 10295339-10295383(-) |
| Potential amino acid sequence |
MVLLKSWRRRLDQSRAVVISKVASKTNDSAGDGTTTASVLAREIIKLGLLSVTSGANPVSLKKG IDKTVHGLIEELEKKARPVKGSGDIKGC*(+) MISRARTEAVVVPSPAESLVLLATFDITTALDWSSLLLQLFNKTMHCFVYSFLK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |