Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0179900_circ_g.1 |
ID in PlantcircBase | osa_circ_013476 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 4440630-4440696 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os02g0179900 |
Parent gene annotation |
Similar to Negative elongation factor E (NELF-E) (RD protein). S plice isoform 2. (Os02t0179900-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | pistil |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0179900-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.28731704 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4440638-4440632(+) 4440671-4440634(-) |
Potential amino acid sequence |
MSSKKVPFHRHKENEEARKKD*(+) MSVEWNLLRTHPNPSSSPLRSPYVGGMEPSSNSS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |