Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G04560_circ_g.3 |
ID in PlantcircBase | ath_circ_036417 |
Alias | At_ciR3820 |
Organism | Arabidpsis thaliana |
Position | chr5: 1315088-1315347 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | AT5G04560 |
Parent gene annotation |
Transcriptional activator DEMETER |
Parent gene strand | + |
Alternative splicing | AT5G04560_circ_g.4 AT5G04560_circ_g.5 AT5G04560_circ_g.6 AT5G04560_circ_g.7 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT5G04560.3:2 AT5G04560.1:2 AT5G04560.2:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.397903663 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1315289-1315344(+) |
Potential amino acid sequence |
MGWVPLQPLPESLQLHLLELDYLLSIRGLGLKSVECVRLLTLHNLAFPVDTNVGRIAVRMGWVP LQPLPESLQLHLLELDYLLSIRGLGLKSVECVRLLTLHNLAFPVDTNVGRIAVRMGWVPLQPLP ESLQLHLLELDYLLSIRGLGLKSVECVRLLTLHNLAFPVDTNVGRIAVRMGWVPLQPLPESLQL HLLE(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |