Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0293100_circ_g.5 |
| ID in PlantcircBase | osa_circ_011225 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 11376774-11377501 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0293100 |
| Parent gene annotation |
Similar to Telomerase reverse transcriptase. (Os12t0293100-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0293100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.168915511 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11377326-11377447(-) 11376813-11377395(-) |
| Potential amino acid sequence |
MPRRRRRRRAAPGGQVPPELRLAYGARALTLGRAVFSLLPSPRHCESPCPACRGRVASGCLACR RWEHLLRDGDPVAYRRLITRAVCAIAADDLSAPPPPRYTPGNSGHSQARLVREMMKSIVADQSH GTKNVLCNGLHEVHDSWWKGKAKREKKTRK*(-) MEPRTSSAMVCTRCTIAGGRERPKGRRKRENKSFRRRFKIPPQTVKSP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |