Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0107000_circ_g.1 |
ID in PlantcircBase | osa_circ_000071 |
Alias | Os01circ00714/Os_ciR2352, |
Organism | Oryza sativa |
Position | chr1: 385580-385923 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, find_circ, CIRI-long |
Parent gene | Os01g0107000 |
Parent gene annotation |
Similar to peroxin Pex14. (Os01t0107000-01);Peroxisome membrane anchor protein Pex14p, N-terminal domain containing protein. (Os 01t0107000-02) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 5/4/18 |
Tissues | leaf/root/shoot, root, seed, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0107000-02:2 Os01t0107000-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_011265 |
PMCS | 0.532627499 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
385608-385815(-) 385869-385582(-) |
Potential amino acid sequence |
MLQLLLHNKMVLVEVNSQTIWYFKPHSQCGRITYRMLLTFLDIQK*(-) MREDYIQNAVNFLGHPKVKGSPVFYRRSFLEKKGLTKEEIDEAFRRVPDPQPNSTDVAAVASQQ DGSGRGEFSDNLVLQTPQPMREDYIQNAVNFLGHPKVKGSPVFYRRSFLEKKGLTKEEIDEAFR RVPDPQPNSTDVAAVASQQDGSGRGEFSDNLVLQTPQPMREDYIQNAVNFLGHPKVKGSPVFYR RSFLEKKGLTKEEIDEAFRRVPDPQPNSTDVAAVASQQDGSGRGEFSDNLVLQTPQPMREDYIQ NAVNFLGHPKVKGSPVFYRRSFLEKKGLTKEEIDEAFRRVPDPQPNSTDVAAVASQQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017; this study |