Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0107000_circ_g.1 |
| ID in PlantcircBase | osa_circ_000071 |
| Alias | Os01circ00714/Os_ciR2352, |
| Organism | Oryza sativa |
| Position | chr1: 385580-385923 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, find_circ, CIRI-long |
| Parent gene | Os01g0107000 |
| Parent gene annotation |
Similar to peroxin Pex14. (Os01t0107000-01);Peroxisome membrane anchor protein Pex14p, N-terminal domain containing protein. (Os 01t0107000-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 5/4/18 |
| Tissues | leaf/root/shoot, root, seed, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0107000-02:2 Os01t0107000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011265 |
| PMCS | 0.532627499 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
385608-385815(-) 385869-385582(-) |
| Potential amino acid sequence |
MLQLLLHNKMVLVEVNSQTIWYFKPHSQCGRITYRMLLTFLDIQK*(-) MREDYIQNAVNFLGHPKVKGSPVFYRRSFLEKKGLTKEEIDEAFRRVPDPQPNSTDVAAVASQQ DGSGRGEFSDNLVLQTPQPMREDYIQNAVNFLGHPKVKGSPVFYRRSFLEKKGLTKEEIDEAFR RVPDPQPNSTDVAAVASQQDGSGRGEFSDNLVLQTPQPMREDYIQNAVNFLGHPKVKGSPVFYR RSFLEKKGLTKEEIDEAFRRVPDPQPNSTDVAAVASQQDGSGRGEFSDNLVLQTPQPMREDYIQ NAVNFLGHPKVKGSPVFYRRSFLEKKGLTKEEIDEAFRRVPDPQPNSTDVAAVASQQ(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017; this study |