Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0808100_circ_g.5 |
| ID in PlantcircBase | osa_circ_004499 |
| Alias | Os_ciR6202 |
| Organism | Oryza sativa |
| Position | chr1: 34311123-34311836 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0808100 |
| Parent gene annotation |
Similar to BZIP transcription factor. (Os01t0808100-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/3 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0808100-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.236362465 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34311834-34311187(+) 34311141-34311797(-) |
| Potential amino acid sequence |
MASDSSHQCLDLLMYQSLDLYQQ*(+) MRGIRCHTNLNNVQPTQVTDFGALAQSAGFRIEDLANLSTNGLFNLKSNAHTIINDPLQFENYV KSISPSNITTTATVTVVDPQTLVPQKGAQLNLVTIRTGNVENWGESTIADTSPRTDTSTDPDTD ERNQMPYKFEQRATYSSY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |