Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0286600_circ_g.4 |
| ID in PlantcircBase | osa_circ_011141 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 10939203-10939726 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os12g0286600 |
| Parent gene annotation |
Alpha/beta hydrolase fold-1 domain containing protein. (Os12t028 6600-01) |
| Parent gene strand | - |
| Alternative splicing | Os12g0286600_circ_g.2 Os12g0286600_circ_g.3 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0286600-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.331643814 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10939405-10939723(-) |
| Potential amino acid sequence |
MYPVKRTYWFDIYKNIDKIPQVTCPVLIIHI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |