Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0199900_circ_g.3 |
ID in PlantcircBase | osa_circ_013695 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 5597415-5598602 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0199900 |
Parent gene annotation |
Similar to 26S proteasome regulatory complex subunit p42D. (Os02 t0199900-01);Similar to 26S protease regulatory subunit S10B. (O s02t0199900-02);Similar to 26S protease regulatory subunit S10B. (Os02t0199900-03) |
Parent gene strand | - |
Alternative splicing | Os02g0199900_circ_g.1 Os02g0199900_circ_g.2 Os02g0199900_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0199900-02:4 Os02t0199900-03:4 Os02t0199900-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.193887444 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5598109-5597446(+) 5597417-5598602(-) |
Potential amino acid sequence |
MIVSVVMSRTTRVPEVNFSLSTLLRQPTTYLGPLLALTIKRSLSRGRRTSPMICPTLCRDFKSS SVFVKSFLAFFRFSLIDDHVHSQTFP*(+) MRENLKNAKKDFTKTEDDLKSLQSVGQIIGEVLRPLDNERFIVKASSGPRYVVGCRSKVDKEKL TSGTRVVLDMTTLTIMRTLPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNP ELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKIVSSAIIDKYIGESARLIREMFG YARDHQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |