Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_13G104300_circ_g.1 |
| ID in PlantcircBase | gma_circ_009084 |
| Alias | circRNA2967 |
| Organism | Glycine max |
| Position | chr13: 21899280-21899522 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | CIRI, CIRCexplorer |
| Parent gene | GLYMA_13G104300 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | pod |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH19165:1 KRH19160:1 KRH19171:1 KRH19164:1 KRH19163:1 KRH19158:1 KRH19159:1 KRH19162:1 KRH19172:1 KRH19166:1 KRH19168:1 KRH19173:1 KRH19174:1 KRH19161:1 KRH19169:1 KRH19167:1 KRH19175:1 KRH19170:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.301561934 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21899401-21899417(-) |
| Potential amino acid sequence |
MRLFPCHQQFKGTSHHLLKQVHLKGKRLLLGLLSLHQLLQDHSISLQRHFHLLQQLHPLRRLKT LNHPNLQVRAP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021a |