Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0286500_circ_g.1 |
| ID in PlantcircBase | osa_circ_019253 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 9878836-9879259 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os03g0286500 |
| Parent gene annotation |
Similar to RNA-binding region containing protein 1 (HSRNASEB) (s sDNA binding protein SEB4) (CLL-associated antigen KW-5). Splice isoform 2. (Os03t0286500-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0286500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.253680601 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9879009-9879233(-) 9878954-9879238(-) |
| Potential amino acid sequence |
MLAANGMMPVYPYYQYHYHGAQGLGVPAAHFFPPVSAAAVTTVPAIISKPTVMAPPKGTPRTTS LT*(-) MARRAWASPPPTSSRRSRPQPSPPCPPSSPSPPSWPLPKVLPELRR*(-) |
| Sponge-miRNAs | osa-miR1846d-3p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |