Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0192500_circ_g.5 |
| ID in PlantcircBase | osa_circ_018319 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 4817201-4817549 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0192500 |
| Parent gene annotation |
Sporulation stage II, protein E C-terminal domain containing pro tein. (Os03t0192500-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0192500_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0192500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.131814661 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4817482-4817546(+) |
| Potential amino acid sequence |
MSSVTLPTLILASGAAMLPHPSKEQAICEVARGNKSSEVKSSDRMSSVTLPTLILASGAAMLPH PSKEQAICEVARGNKSSEVKSSDRMSSVTLPTLILASGAAMLPHPSKEQAICEVARGNKSSEVK SSDRMSSVTLPTLILASGAAMLPHPSK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |