Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT5G03650_circ_g.21 |
| ID in PlantcircBase | ath_circ_036218 |
| Alias | AT5G03650_C1, AT5G03650_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr5: 936634-936894 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT5G03650 |
| Parent gene annotation |
1,4-alpha-glucan-branching enzyme 2-2, chloroplastic/amyloplasti c |
| Parent gene strand | + |
| Alternative splicing | AT5G03650_circ_g.11 AT5G03650_circ_g.12 AT5G03650_circ_g.13 AT5G03650_circ_g.14 AT5G03650_circ_g.15 AT5G03650_circ_g.16 AT5G03650_circ_g.17 AT5G03650_circ_g.18 AT5G03650_circ_g.19 AT5G03650_circ_g.20 AT5G03650_circ_g.22 AT5G03650_circ_g.23 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT5G03650.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.262152662 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
936707-936640(+) 936869-936681(+) |
| Potential amino acid sequence |
MTNAAADLILGMQIISDTADYKNLIRQCNILKRITVMD* MQHLEENYGNGLIFPEASSVFLMVA* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |