Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0553200_circ_g.3 |
| ID in PlantcircBase | osa_circ_040143 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 21919699-21919771 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os09g0553200 |
| Parent gene annotation |
UDPase, Pollen mother cell (PMC) meiosis, Pollen development (Os 09t0553200-01) |
| Parent gene strand | + |
| Alternative splicing | Os09g0553200_circ_g.4 Os09g0553200_circ_g.5 Os09g0553200_circ_g.6 Os09g0553200_circ_g.7 Os09g0553200_circ_g.8 Os09g0553200_circ_g.9 Os09g0553200_circ_g.10 Os09g0553200_circ_g.11 Os09g0553200_circ_g.12 |
| Support reads | 2 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0553200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.234016667 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21919716-21919701(-) |
| Potential amino acid sequence |
MAWGIPVPTRYQVFHCYSRRGTHHHGLGDTCANKVSSFPLLFKEGNTSPWPGGYLCQQGIKFST VIQGGEHITMAWGI(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |