Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G11620_circ_g.3 |
| ID in PlantcircBase | ath_circ_021041 |
| Alias | AT3G11620_C1, AT3G11620_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 3671035-3671574 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT3G11620 |
| Parent gene annotation |
Alpha/beta-Hydrolases superfamily protein |
| Parent gene strand | - |
| Alternative splicing | AT3G11620_circ_g.1 AT3G11620_circ_g.2 AT3G11620_circ_g.4 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT3G11620.8:4 AT3G11620.9:4 AT3G11620.6:4 AT3G11620.3:4 AT3G11620.4:4 AT3G11620.2:4 AT3G11620.7:4 AT3G11620.5:4 AT3G11620.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.122228349 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3671572-3671544(-) |
| Potential amino acid sequence |
MTEMMEIQAENPTFHVLFIPGNPGVVSFYKDFLESLYEFLGGNASVIAIGQISHTSKDWESGRL FSFQEQIDHKFDDGDDGNSS* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |