Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G11620_circ_g.3 |
ID in PlantcircBase | ath_circ_021041 |
Alias | AT3G11620_C1, AT3G11620_C1 |
Organism | Arabidpsis thaliana |
Position | chr3: 3671035-3671574 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | AT3G11620 |
Parent gene annotation |
Alpha/beta-Hydrolases superfamily protein |
Parent gene strand | - |
Alternative splicing | AT3G11620_circ_g.1 AT3G11620_circ_g.2 AT3G11620_circ_g.4 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G11620.8:4 AT3G11620.9:4 AT3G11620.6:4 AT3G11620.3:4 AT3G11620.4:4 AT3G11620.2:4 AT3G11620.7:4 AT3G11620.5:4 AT3G11620.1:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.122228349 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3671572-3671544(-) |
Potential amino acid sequence |
MTEMMEIQAENPTFHVLFIPGNPGVVSFYKDFLESLYEFLGGNASVIAIGQISHTSKDWESGRL FSFQEQIDHKFDDGDDGNSS* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |