Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0798700_circ_g.3 |
| ID in PlantcircBase | osa_circ_016965 |
| Alias | Os_ciR2905 |
| Organism | Oryza sativa |
| Position | chr2: 34005701-34005948 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os02g0798700 |
| Parent gene annotation |
Neurochondrin domain containing protein. (Os02t0798700-01) |
| Parent gene strand | + |
| Alternative splicing | Os02g0798700_circ_g.2 |
| Support reads | 4/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0798700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_012422 |
| PMCS | 0.364824496 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34005723-34005717(+) 34005788-34005941(-) |
| Potential amino acid sequence |
MIEQNGMMIDTGNMFLACDTIINFLSNMKNAHIQMGSCFVGLLKALVSWTGYRLPY*(+) MMVSHAKNMLPVSIIIPFCSIILIRQSITSP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |