Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0798700_circ_g.3 |
ID in PlantcircBase | osa_circ_016965 |
Alias | Os_ciR2905 |
Organism | Oryza sativa |
Position | chr2: 34005701-34005948 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0798700 |
Parent gene annotation |
Neurochondrin domain containing protein. (Os02t0798700-01) |
Parent gene strand | + |
Alternative splicing | Os02g0798700_circ_g.2 |
Support reads | 4/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0798700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_012422 |
PMCS | 0.364824496 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34005723-34005717(+) 34005788-34005941(-) |
Potential amino acid sequence |
MIEQNGMMIDTGNMFLACDTIINFLSNMKNAHIQMGSCFVGLLKALVSWTGYRLPY*(+) MMVSHAKNMLPVSIIIPFCSIILIRQSITSP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |