Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0189100_circ_g.1 |
| ID in PlantcircBase | osa_circ_006374 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 6171687-6171755 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os10g0189100 |
| Parent gene annotation |
Plastidic phosphoglucomutase, Starch synthesis in rice pollen (O s10t0189100-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0189100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.201690217 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6171705-6171689(-) |
| Potential amino acid sequence |
METHFRSTIAVGSQHQRQLPTKYMETHFRSTIAVGSQHQRQLPTKYMETHFRSTIAVGSQHQRQ LPTKYMETHF(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |