Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc05g015650.2_circ_g.2 |
| ID in PlantcircBase | sly_circ_001713 |
| Alias | 5:11607742|11608482 |
| Organism | Solanum lycopersicum |
| Position | chr5: 11607742-11608482 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | Segemehl, CIRI |
| Parent gene | Solyc05g015650.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | - |
| Alternative splicing | Solyc05g015650.2_circ_g.1 |
| Support reads | 10 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Solyc05g015650.2.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.847062877 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11608464-11607805(+) 11608110-11607756(+) 11608425-11608452(-) |
| Potential amino acid sequence |
MRFTALTFVGSDEYPQSGDICRIVNFCF*(+) MLLWPFSLIRFEALHSHPACANIWFVIQQLQKPHSDPAYPSTREHPGSDLGDEIHCSHLCWLR* (+) MLDHYGVSAAAESQTKYLHKLDENAMLQTLSERRAIEAYESYKWRDFSDKETQTAPVQAFKQLE DFKYPTYPPDITTFGSNPDEYTTIFDQDQIGTSLEDEMSLTIAQKQKFTIRHISPDWGYSSEPT KVRAVNLITEI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Tan et al., 2017; Yin et al., 2018 |