Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0218500_circ_g.1 |
ID in PlantcircBase | osa_circ_030210 |
Alias | Os_ciR3123 |
Organism | Oryza sativa |
Position | chr6: 6089129-6090169 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os06g0218500 |
Parent gene annotation |
MCM family protein. (Os06t0218500-01);MCM family protein. (Os06t 0218500-02);Non-protein coding transcript. (Os06t0218500-03) |
Parent gene strand | - |
Alternative splicing | Os06g0218500_circ_g.2 |
Support reads | 4/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0218500-01:4 Os06t0218500-02:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_016807 |
PMCS | 0.285485743 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6089725-6089236(+) 6090112-6089165(+) 6089180-6090129(-) |
Potential amino acid sequence |
MLLHIVNIPSQHGQCPHYFRITCLAFLFFSVLCLPESKGHTRDIGKNIHIRGTTVKIISSRFHQ LNI*(+) MDSVHITSGSLVLPFFSSVFFACPNQKAIPET*(+) MFLPMSLVWPFDSGKQRTLKKRKARQVIRK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |