Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0218500_circ_g.1 |
| ID in PlantcircBase | osa_circ_030210 |
| Alias | Os_ciR3123 |
| Organism | Oryza sativa |
| Position | chr6: 6089129-6090169 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0218500 |
| Parent gene annotation |
MCM family protein. (Os06t0218500-01);MCM family protein. (Os06t 0218500-02);Non-protein coding transcript. (Os06t0218500-03) |
| Parent gene strand | - |
| Alternative splicing | Os06g0218500_circ_g.2 |
| Support reads | 4/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0218500-01:4 Os06t0218500-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_016807 |
| PMCS | 0.285485743 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6089725-6089236(+) 6090112-6089165(+) 6089180-6090129(-) |
| Potential amino acid sequence |
MLLHIVNIPSQHGQCPHYFRITCLAFLFFSVLCLPESKGHTRDIGKNIHIRGTTVKIISSRFHQ LNI*(+) MDSVHITSGSLVLPFFSSVFFACPNQKAIPET*(+) MFLPMSLVWPFDSGKQRTLKKRKARQVIRK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |