Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G25760_circ_g.7 |
ID in PlantcircBase | ath_circ_014828 |
Alias | At_ciR1918 |
Organism | Arabidpsis thaliana |
Position | chr2: 10988049-10988180 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | AT2G25760 |
Parent gene annotation |
Protein kinase family protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 4 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G25760.2:1 AT2G25760.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.228606817 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10988160-10988051(-) |
Potential amino acid sequence |
MYKLDRKLGKGGFGQVYVGRKMGTSTSNARFGPGALEVQVGNSPMYKLDRKLGKGGFGQVYVGR KMGTSTSNARFGPGALEVQVGNSPMYKLDRKLGKGGFGQVYVGRKMGTSTSNARFGPGALEVQV GNSPMYKLDRKLGKGGFGQVYVGRKMGTSTSNARFGPGALE(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |