Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0515700_circ_g.5 |
| ID in PlantcircBase | osa_circ_037682 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 25587745-25588035 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os08g0515700 |
| Parent gene annotation |
Protein of unknown function DUF547 domain containing protein. (O s08t0515700-01) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0515700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.218443013 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25587786-25587762(+) 25587846-25587982(-) 25587824-25587982(-) |
| Potential amino acid sequence |
MAHEEQLCFWINIHNALVMHAFMAYGLQEKRMKNTDMILKIADKTT*(+) MHHQSVVDVDPKTELLFMCHFCWVNFLKSFYQRSSESCLCFSCVSPEVHKP*(-) MLIQKQSCSSCAIFVGSIFSSRFISDLQNHVCVFHAFLLKSISHKSMHHQSVVDVDPKTELLFM CHFCWVNFLKSFYQRSSESCLCFSCVSPEVHKP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |