Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | orai.013G213900_circ_g.1 |
ID in PlantcircBase | gra_circ_001451 |
Alias | Chr13:53475283|53475962 |
Organism | Gossypium raimondii |
Position | chrChr13: 53475283-53475962 JBrowse» |
Reference genome | Graimondii_221 |
Type | e-circRNA |
Identification method | CIRI |
Parent gene | Gorai.013G213900 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Gorai.013G213900.1:2 Gorai.013G213900.3:2 Gorai.013G213900.2:2 Gorai.013G213900.4:2 |
Conservation Information | |
---|---|
Conserved circRNAs | pbe_circ_000257 |
PMCS | 0.550794583 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
53475407-53475864(-) |
Potential amino acid sequence |
MATWNVIATMLLTPMLCHLVAFQPFFSAKFLLLCQQSSPCNPFTFAFRDGGCRRIAVPVPFPLI NEPIVYLLQL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zhao et al., 2017b |