Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G44050_circ_g.2 |
ID in PlantcircBase | ath_circ_018269 |
Alias | At_ciR3718 |
Organism | Arabidpsis thaliana |
Position | chr2: 18225205-18225728 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT2G44050 |
Parent gene annotation |
6,7-dimethyl-8-ribityllumazine synthase, chloroplastic |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G44050.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.142670977 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18225562-18225725(+) |
Potential amino acid sequence |
MDQALNRSGGKAGNKGAETALTAIRGDTTHYDAVANSAASGVLSASINSGVPCIFGVLTCEDMD QALNRSGGKAGNKGAETALTAIRGDTTHYDAVANSAASGVLSASINSGVPCIFGVLTCEDMDQA LNRSGGKAGNKGAETALTAIRGDTTHYDAVANSAASGVLSASINSGVPCIFGVLTCEDMDQALN RSGGKAGNKGAETALTA(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |