Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G44050_circ_g.2 |
| ID in PlantcircBase | ath_circ_018269 |
| Alias | At_ciR3718 |
| Organism | Arabidpsis thaliana |
| Position | chr2: 18225205-18225728 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI-full |
| Parent gene | AT2G44050 |
| Parent gene annotation |
6,7-dimethyl-8-ribityllumazine synthase, chloroplastic |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT2G44050.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.142670977 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18225562-18225725(+) |
| Potential amino acid sequence |
MDQALNRSGGKAGNKGAETALTAIRGDTTHYDAVANSAASGVLSASINSGVPCIFGVLTCEDMD QALNRSGGKAGNKGAETALTAIRGDTTHYDAVANSAASGVLSASINSGVPCIFGVLTCEDMDQA LNRSGGKAGNKGAETALTAIRGDTTHYDAVANSAASGVLSASINSGVPCIFGVLTCEDMDQALN RSGGKAGNKGAETALTA(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |