Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0351500_circ_g.3 |
| ID in PlantcircBase | osa_circ_019823 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 13182973-13183354 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os03g0351500 |
| Parent gene annotation |
Similar to Superoxide dismutase. (Os03t0351500-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0351500_circ_g.1 Os03g0351500_circ_g.2 Os03g0351500_circ_g.4 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0351500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.161866841 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13183004-13183018(+) 13183341-13183353(-) |
| Potential amino acid sequence |
MEHQKMRPAMLVILEMSPLEKMVLLISMLLTVRATLQSCRKGAWSTRR*(+) MDISNTIFSSGDISKITSMAGLIFWCSMLLSGRIVVWP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |