Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0156300_circ_g.4 |
| ID in PlantcircBase | osa_circ_026657 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 3296040-3296462 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0156300 |
| Parent gene annotation |
Similar to protein disulfide isomerase. (Os05t0156300-01);Simila r to Protein disulfide isomerase. (Os05t0156300-02);Similar to P rotein disulfide isomerase. (Os05t0156300-03) |
| Parent gene strand | - |
| Alternative splicing | Os05g0156300_circ_g.5 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0156300-03:3 Os05t0156300-01:3 Os05t0156300-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.226526458 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3296234-3296082(+) 3296099-3296431(-) |
| Potential amino acid sequence |
MLAVTTPWGIELYKDIFGFIKDNRVEGLWGKNHDTRRNCSYLYIGGSLPRQCVCQHQDWQ*(+) MRVLLLPILMLTNTLPWQRTTNVKIAAVPSSVVVLTPETFDSVVLDETKDVLVEFYAPWCGHCK HLAPIYEKLASVYKQDEGVVIANLDADKHTALAENHQCKDSCSSF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |