Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_13G148400_circ_g.1 |
| ID in PlantcircBase | gma_circ_009109 |
| Alias | circRNA2152 |
| Organism | Glycine max |
| Position | chr13: 26197959-26199744 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | CIRI, CIRCexplorer |
| Parent gene | GLYMA_13G148400 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | pod |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH19991:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.03154162 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26198958-26198002(+) 26199706-26199738(-) |
| Potential amino acid sequence |
MNCNTGSHFSFSSIPNLQIIVPGLLLACLVLLNPTL*(+) MGSRVAIHYVAKWKGITFMTSRQGMGVGGGTPYGFDVGQSERGTVLKGLDLGVQGMRVGGQVL* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021a |