Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc01g106860.2_circ_g.2 |
| ID in PlantcircBase | sly_circ_000485 |
| Alias | 1:86295636|86296536 |
| Organism | Solanum lycopersicum |
| Position | chr1: 94534836-94535736 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc01g106770.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | + |
| Alternative splicing | Solyc01g106860.2_circ_g.1 |
| Support reads | 3 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | NA:0 Solyc01g106770.2.1:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.246808657 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
94534842-94534859(+) 94535050-94535650(-) |
| Potential amino acid sequence |
MRCLAALARWEELNNLCKEYWTPAEPAARLEMAPMAANAAWNMGEWDQMAEYVSRLDDGDETKL RVLGNTASSGDGSSNGTFYRAVLLVRRGKYDEAREYVERARKCLATELAALVLESYERAYSNMV RVQQLSELEEVIEYCTLPPTGNPVAEGRRALVRNMWNERIKGAKRNVEDVCDALLL*(+) MFQAALAAIGAISSRAAGSAGVQYSLQRLLSSSHRARAARHRIRPRHFFLHPLCAHSTYCEQGL FFLQQQGFP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |