Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0265100_circ_g.1 |
| ID in PlantcircBase | osa_circ_019000 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 8737922-8738638 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0265100 |
| Parent gene annotation |
Glycosyl transferase, group 1 domain containing protein. (Os03t0 265100-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0265100_circ_g.2 Os03g0265100_circ_g.3 Os03g0265100_circ_g.4 Os03g0265100_circ_g.5 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0265001-01:1 Os03t0265100-01:3 Os03t0265001-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.152415249 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8737978-8737984(+) 8738617-8737984(+) 8738128-8738636(-) |
| Potential amino acid sequence |
MGDEMLVVTTHKGAPEEFHGAKVIGSWSFPCPLYQNVPLSLALSPRIFSAVAKFKPDIIHATSP GVMLHLWVQESLPELHQASARDGR*(+) MLLHLELCYISGYKNRFQNFIKHLREMGDEMLVVTTHKGAPEEFHGAKVIGSWSFPCPLYQNVP LSLALSPRIFSAVAKFKPDIIHATSPGVMLHLWVQESLPELHQASARDGR*(+) MELLGSSLVRGHHQHLIAHLSQMLDEVLEAILVPRDVT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |