Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0528300_circ_g.1 |
| ID in PlantcircBase | osa_circ_039936 |
| Alias | Os_ciR11902 |
| Organism | Oryza sativa |
| Position | chr9: 20677975-20678077 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os09g0528300 |
| Parent gene annotation |
Similar to RNA polymerase II mediator complex protein-related. ( Os09t0528300-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os09t0528300-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.412491667 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20678019-20677976(+) 20678071-20678068(-) |
| Potential amino acid sequence |
MQLLSTSRVNSSGFFPSSIKLESIGLALSDLVLCDAAVEHVSGELVRILPVIDQT*(+) MTGRILTSSPETCSTAASQRTRSLRARPMLSSLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDA FKFDR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |