Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0137500_circ_g.6 |
| ID in PlantcircBase | osa_circ_029597 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 2007065-2007299 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0137500 |
| Parent gene annotation |
Similar to predicted protein. (Os06t0137500-01);Brix domain cont aining protein. (Os06t0137500-02) |
| Parent gene strand | - |
| Alternative splicing | Os06g0137500_circ_g.7 Os06g0137500_circ_g.8 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0137500-01:2 Os06t0137500-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.270902766 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2007274-2007282(-) 2007249-2007282(-) |
| Potential amino acid sequence |
MQVIPNSCYVKRGTYELKKIVEYANNRDFTSLVVVHTNRREPEGTCLY*(-) MLKEELMNSRKLWNMQITEISLHLLLSTQTEGNLRGPAFIEELMQVIPNSCYVKRGTYELKKIV EYANNRDFTSLVVVHTNRREPEGTCLY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |