Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.011G145600_circ_g.1 |
| ID in PlantcircBase | gra_circ_001230 |
| Alias | Chr11:23513713|23518628 |
| Organism | Gossypium raimondii |
| Position | chrChr11: 23513713-23518628 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | ue-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.011G145600 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.011G145600.3:6 Gorai.011G145600.1:7 Gorai.011G145600.2:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.094313454 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23517711-23517681(+) 23513746-23518598(-) |
| Potential amino acid sequence |
MCKGFFMVTCGTLGLSTATVKLIGADGEEHVACSVGTGPVDSAYKAIDLITKVVMAIKCRGEHV LGGLYTGINTQHIVMSSKMVEDYTGLHIQPHKAIVGANAFAHESGIHQDGMLKHKGTYEIISPE DIGLERSNEAGIVLGKLSGRHALKDRLKELGYELDDEQLGNIFWRFKAVAEQKKRVTDADLIAL VSDEVFQPEVVWKLHDLQVTRDS*(+) MLATTFYCHHNLCNEINSFIS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |