Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0200300_circ_g.9 |
ID in PlantcircBase | osa_circ_036296 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 5807934-5807986 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, circRNA_finder |
Parent gene | Os08g0200300 |
Parent gene annotation |
Similar to Photosystem II 10 kDa polypeptide (Fragment). (Os08t0 200300-02) |
Parent gene strand | - |
Alternative splicing | Os08g0200300_circ_g.1 Os08g0200300_circ_g.2 Os08g0200300_circ_g.3 Os08g0200300_circ_g.4 Os08g0200300_circ_g.5 Os08g0200300_circ_g.6 Os08g0200300_circ_g.7 Os08g0200300_circ_g.8 Os08g0200300_circ_g.10 |
Support reads | 7 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0200300-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.114779874 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5807972-5807966(+) 5807952-5807966(+) 5807974-5807958(-) |
Potential amino acid sequence |
MPPPIPCSSCQMHQYRLTCHLQSRALPARCINID*(+) MHQYRLTCHLQSRALPARCINID*(+) MSVDIDASGRKSTGLEVACQSILMHLAGRARDWRWHVSRY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |