Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0200300_circ_g.9 |
| ID in PlantcircBase | osa_circ_036296 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 5807934-5807986 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, circRNA_finder |
| Parent gene | Os08g0200300 |
| Parent gene annotation |
Similar to Photosystem II 10 kDa polypeptide (Fragment). (Os08t0 200300-02) |
| Parent gene strand | - |
| Alternative splicing | Os08g0200300_circ_g.1 Os08g0200300_circ_g.2 Os08g0200300_circ_g.3 Os08g0200300_circ_g.4 Os08g0200300_circ_g.5 Os08g0200300_circ_g.6 Os08g0200300_circ_g.7 Os08g0200300_circ_g.8 Os08g0200300_circ_g.10 |
| Support reads | 7 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0200300-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.114779874 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5807972-5807966(+) 5807952-5807966(+) 5807974-5807958(-) |
| Potential amino acid sequence |
MPPPIPCSSCQMHQYRLTCHLQSRALPARCINID*(+) MHQYRLTCHLQSRALPARCINID*(+) MSVDIDASGRKSTGLEVACQSILMHLAGRARDWRWHVSRY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |