Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0797000_circ_g.2 |
| ID in PlantcircBase | osa_circ_022280 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 33196685-33196859 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os03g0797000 |
| Parent gene annotation |
Similar to Indole synthase. (Os03t0797000-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0797000_circ_g.1 |
| Support reads | 3 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0797000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.083333333 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33196811-33196736(+) 33196807-33196839(-) 33196689-33196839(-) |
| Potential amino acid sequence |
MTESNVAPFLRARVAAAMYAGLFNDSHEVTHSAL*(+) MLKGVIPELSCPIVIFTYYNPILKRGVSNFMAIIKQAGVHGCSNACS*(-) MAAATRALKKGATFDSVIAMLKGVIPELSCPIVIFTYYNPILKRGVSNFMAIIKQAGVHGCSNA CS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |