Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0716700_circ_g.7 |
ID in PlantcircBase | osa_circ_032356 |
Alias | Os_ciR10644 |
Organism | Oryza sativa |
Position | chr6: 30446264-30446644 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os06g0716700 |
Parent gene annotation |
Similar to Heat shock protein 90. (Os06t0716700-01);Similar to H eat shock protein 90. (Os06t0716700-02);Similar to Heat shock pr otein 90. (Os06t0716700-03) |
Parent gene strand | - |
Alternative splicing | Os06g0716700_circ_g.4 Os06g0716700_circ_g.5 Os06g0716700_circ_g.6 Os06g0716700_circ_g.8 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0716700-01:1 Os06t0716700-03:2 Os06t0716700-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006954* osi_circ_016625 |
PMCS | 0.577353208 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30446316-30446300(+) 30446624-30446331(+) 30446601-30446577(-) |
Potential amino acid sequence |
MMPNLTDFPNSFQNLAYWPFFSSIALFSSSVLSLLLYSSGSSSASFLIMSRALRISFFLMVFRL LCCWSISRDTLRGNVSESTRPFQISEALQDGSC*(+) MCPSRRDPFKSQKLCKTVPVSCVFNDAQLD*(+) MLQQHSSLKTIKKKLIRKALDMIRKLAEEDPDEYSNKDKTDEEKSAMEEKKGQYAKFWNEFGKS VKLGIIEDATNRNRLAKLLRFERVSSTRTHCLSMYHEKCSNNIAA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |