Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0716700_circ_g.7 |
| ID in PlantcircBase | osa_circ_032356 |
| Alias | Os_ciR10644 |
| Organism | Oryza sativa |
| Position | chr6: 30446264-30446644 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0716700 |
| Parent gene annotation |
Similar to Heat shock protein 90. (Os06t0716700-01);Similar to H eat shock protein 90. (Os06t0716700-02);Similar to Heat shock pr otein 90. (Os06t0716700-03) |
| Parent gene strand | - |
| Alternative splicing | Os06g0716700_circ_g.4 Os06g0716700_circ_g.5 Os06g0716700_circ_g.6 Os06g0716700_circ_g.8 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0716700-01:1 Os06t0716700-03:2 Os06t0716700-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006954* osi_circ_016625 |
| PMCS | 0.577353208 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30446316-30446300(+) 30446624-30446331(+) 30446601-30446577(-) |
| Potential amino acid sequence |
MMPNLTDFPNSFQNLAYWPFFSSIALFSSSVLSLLLYSSGSSSASFLIMSRALRISFFLMVFRL LCCWSISRDTLRGNVSESTRPFQISEALQDGSC*(+) MCPSRRDPFKSQKLCKTVPVSCVFNDAQLD*(+) MLQQHSSLKTIKKKLIRKALDMIRKLAEEDPDEYSNKDKTDEEKSAMEEKKGQYAKFWNEFGKS VKLGIIEDATNRNRLAKLLRFERVSSTRTHCLSMYHEKCSNNIAA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |