Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | POPTR_0005s14170_circ_g.1 |
ID in PlantcircBase | pop_circ_001569 |
Alias | Chr05:11052198-11052991 |
Organism | Populus trichocarpa |
Position | chr5: 11281540-11282333 JBrowse» |
Reference genome | Populus trichocarpa genome v3.0 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | POPTR_0005s14170 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | stem xylem |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | POPTR_0005s14170.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.145403558 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11281560-11281596(+) 11281546-11282148(-) |
Potential amino acid sequence |
MKKMIEHLHSQSPRMVRPDFSTAQSSRDNFGINIPTRSAPTSPFTSPVRSPPRTSNTADMLPYY RMIAKANQVWSAPEMATLDIPGLPPPAFMDITAFSTDSSPLQSPPNLSPQRSARSPTGPPSPLI AKLSIESSPAWRESNANFEVHPLPLPPGASVPSPSVPVPLALSKLESTSMKSHWQKGKLIGRGT FGSVYVASNRETGALCAMKEVEMFPDDPKSAESIKQLEQYICWSKHEENDRASTLSVT*(+) MYCSNCFIDSADFGSSGNISTSFIAHNAPVSLLLAT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Liu et al., 2021 |