Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0323800_circ_g.3 |
ID in PlantcircBase | osa_circ_019570 |
Alias | Os_ciR2519 |
Organism | Oryza sativa |
Position | chr3: 11744239-11744518 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os03g0323800 |
Parent gene annotation |
Similar to ISP42-like protein (Fragment). (Os03t0323800-01) |
Parent gene strand | + |
Alternative splicing | Os03g0323800_circ_g.1 Os03g0323800_circ_g.2 |
Support reads | 8 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0323800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.310772083 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11744247-11744277(+) 11744512-11744277(+) |
Potential amino acid sequence |
MGSLEVPSQSTETIKVPTSHYEFGANFIDPKLILVGRVMTDGRLNARVKCDLTDDLTLKINAQC FYGFLRSSISVN*(+) MHSVFMGSLEVPSQSTETIKVPTSHYEFGANFIDPKLILVGRVMTDGRLNARVKCDLTDDLTLK INAQCFYGFLRSSISVN*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |