Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_19G136200_circ_g.2 |
| ID in PlantcircBase | gma_circ_007635 |
| Alias | gma-circRNA2596 |
| Organism | Glycine max |
| Position | chr19: 39742472-39742770 JBrowse» |
| Reference genome | v2.0.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_19G136200 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRG95199:1 KRG95197:1 KRG95202:1 KRG95194:1 KRG95200:1 KRG95196:1 KRG95198:1 KRG95193:1 KRG95195:1 KRG95201:1 KRG95204:1 KRG95203:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.2105216 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
39742545-39742472(+) 39742490-39742679(-) 39742530-39742767(-) |
| Potential amino acid sequence |
MIILQSANRHIKPVDSLSENSTAYIRPFFMLGAGQFILKKQEVPFKFLDLGICLGDQNSQNPDT GFHIQGILLYQI*(+) MKYLLRFDRGGCLECGILCPGFENFDHQGRYRDRGT*(-) MQPLLDSEPAETLHEILAQI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |