Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d018986_circ_g.3 |
ID in PlantcircBase | zma_circ_009227 |
Alias | Zm07circ00013, AC148167.6_FG001_C1 |
Organism | Zea mays |
Position | chr7: 12039707-12040844 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d018986 |
Parent gene annotation |
Protein WVD2-like 3 |
Parent gene strand | + |
Alternative splicing | Zm00001d018986_circ_g.1 Zm00001d018986_circ_g.2 Zm00001d018986_circ_g.4 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d018986_T001:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.181229668 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12039712-12039721(+) |
Potential amino acid sequence |
MGKIDMSTDEESDCVAICPPNRNAGHEEVVSGSHDEDSSGKQENPYAVNSHMDSNGQEDVSVNL DLLKLIHQQESSVSNSPTKPAVARQQGSGHTVLEPCAVAPERRSSGAGNIARIPHPTSSGEKLS DKSSSSPRSMAKKSPSFTPRKPLQSDNTSHSQDDDSYSVTSSTVTSARAGKTKKTTVAVAPTFV CANRAEKRGEFYTKLEEKRKALEEEKLQAEARKRCNGEN*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |