Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d018986_circ_g.3 |
| ID in PlantcircBase | zma_circ_009227 |
| Alias | Zm07circ00013, AC148167.6_FG001_C1 |
| Organism | Zea mays |
| Position | chr7: 12039707-12040844 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d018986 |
| Parent gene annotation |
Protein WVD2-like 3 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d018986_circ_g.1 Zm00001d018986_circ_g.2 Zm00001d018986_circ_g.4 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d018986_T001:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.181229668 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12039712-12039721(+) |
| Potential amino acid sequence |
MGKIDMSTDEESDCVAICPPNRNAGHEEVVSGSHDEDSSGKQENPYAVNSHMDSNGQEDVSVNL DLLKLIHQQESSVSNSPTKPAVARQQGSGHTVLEPCAVAPERRSSGAGNIARIPHPTSSGEKLS DKSSSSPRSMAKKSPSFTPRKPLQSDNTSHSQDDDSYSVTSSTVTSARAGKTKKTTVAVAPTFV CANRAEKRGEFYTKLEEKRKALEEEKLQAEARKRCNGEN*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |