Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0733800_circ_g.4 |
ID in PlantcircBase | osa_circ_021673 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 30064377-30064838 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0733800 |
Parent gene annotation |
Endoplasmic reticulum oxidoreductin 1 family protein. (Os03t0733 800-00) |
Parent gene strand | - |
Alternative splicing | Os03g0733800_circ_g.1 Os03g0733800_circ_g.2 Os03g0733800_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0733800-00:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.380742045 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30064798-30064836(-) 30064413-30064699(-) |
Potential amino acid sequence |
MCRLRDCSVCECPENEFPEPFKKPYSGLSPDSMICQEGKPQATVDRTLDAKVFKGWIETDNPWT YDDETDNAEMTYVNLQLNPERYTGYTGDSARRIWDSVYKENCPKC*(-) MGLCLQRKLSKMLNCGVTALSGLMMECVGLGIVVSVSAQRMSFLSHSRSLTVAFLQIV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |