Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0582200_circ_g.2 |
| ID in PlantcircBase | osa_circ_020536 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 21418115-21418573 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0582200 |
| Parent gene annotation |
SCAMP family protein. (Os03t0582200-01);SCAMP family protein. (O s03t0582200-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0582200_circ_g.3 Os03g0582200_circ_g.4 Os03g0582200_circ_g.5 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0582200-01:3 Os03t0582200-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.159766667 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21418190-21418115(+) 21418572-21418185(-) |
| Potential amino acid sequence |
MMGKNGGQFLSSNTIPARAAASSLLLISFSRLFSSASFARSSFSLVFIS*(+) MKTREKELLAKEAELNRREKEIKRREEAAARAGIVLEDKNWPPFFPIIHNDIGNEIPVHLQRTQ YVAFASLLGYENKGEGTSCKGSRAKQAREGNQKERGGCSTSWYCVGRQKLASIFPHHP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |