Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0708600_circ_g.4 |
| ID in PlantcircBase | osa_circ_010254 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 28998697-29000212 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0708600 |
| Parent gene annotation |
Similar to RECQL1 protein. (Os11t0708600-01);Similar to ATP-depe ndent DNA helicase, RecQ family protein, expressed. (Os11t070860 0-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0708600-02:3 Os11t0708600-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.119542035 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29000185-28998748(+) 28998751-28999444(-) 28998830-28998842(-) |
| Potential amino acid sequence |
MLSSSYMLQPWSWIRESKGLTTNVIPS*(+) MMELHWLLVLCFPLSRTRAAACMRKTTFRENCYSFRQNLMTSKGKLVH*(-) MSGRDVLVIMAAGGGKSLCYQLPAVLHDGITLVVSPLLSLIQDQGCSMYEEDNIQGELLLVQAE LDDIQGQISALIDRQEELYERESQLKAMLEVSKASNNTINNTPSVGPKDWSGSFLWDSRADDVR FNVFGISSYRQNQREVR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |