Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0289100_circ_g.8 |
ID in PlantcircBase | osa_circ_019279 |
Alias | Os_ciR3359 |
Organism | Oryza sativa |
Position | chr3: 10010813-10011040 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circseq_cup, find_circ |
Parent gene | Os03g0289100 |
Parent gene annotation |
Serine/threonine protein kinase, Carbohydrate metabolism (Os03t0 289100-01);Similar to OSK3. (Os03t0289100-02) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 3/3/216 |
Tissues | root/root/root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0289100-01:1 Os03t0289100-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_012852 |
PMCS | 0.614230368 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10010838-10011037(+) |
Potential amino acid sequence |
MIEVLKALQDLNVSWKKNGQYNMKCRWSVGTQATDMLDVNNSFVDDSIIMDNGDVNGRLPAVIK FEIQSRAQPREIMIEVLKALQDLNVSWKKNGQYNMKCRWSVGTQATDMLDVNNSFVDDSIIMDN GDVNGRLPAVIKFEIQSRAQPREIMIEVLKALQDLNVSWKKNGQYNMKCRWSVGTQATDMLDVN NSFVDDSIIMDNGDVNGRLPAVIKFEIQSRAQPREIMIEVLKALQDLNVSWKKNGQYNMKCRWS VGTQATDMLDVNNSFVDDSIIMDNGDVNGRLPAVIKFEIQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |