Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0289100_circ_g.8 |
| ID in PlantcircBase | osa_circ_019279 |
| Alias | Os_ciR3359 |
| Organism | Oryza sativa |
| Position | chr3: 10010813-10011040 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circseq_cup, find_circ |
| Parent gene | Os03g0289100 |
| Parent gene annotation |
Serine/threonine protein kinase, Carbohydrate metabolism (Os03t0 289100-01);Similar to OSK3. (Os03t0289100-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 3/3/216 |
| Tissues | root/root/root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0289100-01:1 Os03t0289100-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_012852 |
| PMCS | 0.614230368 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10010838-10011037(+) |
| Potential amino acid sequence |
MIEVLKALQDLNVSWKKNGQYNMKCRWSVGTQATDMLDVNNSFVDDSIIMDNGDVNGRLPAVIK FEIQSRAQPREIMIEVLKALQDLNVSWKKNGQYNMKCRWSVGTQATDMLDVNNSFVDDSIIMDN GDVNGRLPAVIKFEIQSRAQPREIMIEVLKALQDLNVSWKKNGQYNMKCRWSVGTQATDMLDVN NSFVDDSIIMDNGDVNGRLPAVIKFEIQSRAQPREIMIEVLKALQDLNVSWKKNGQYNMKCRWS VGTQATDMLDVNNSFVDDSIIMDNGDVNGRLPAVIKFEIQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |