Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G26910_circ_g.14 |
ID in PlantcircBase | ath_circ_015084 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 11486339-11486422 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT2G26910 |
Parent gene annotation |
PEC1 |
Parent gene strand | + |
Alternative splicing | AT2G26910_circ_g.13 |
Support reads | 1 |
Tissues | aerial |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT2G26910.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.1627 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11486348-11486419(+) 11486371-11486341(-) |
Potential amino acid sequence |
MKRGGELIYAGPLGQKSCELIKYFELLFMKRGGELIYAGPLGQKSCELIKYFELLFMKRGGELI YAGPLGQKSCELIKYFELLFMKRGGELIYAGPLGQKSCELIKYFE(+) MSSPPRFMNKSSKYLISSQDFWPSGPAYMSSPPRFMNKSSKYLISSQDFWPSGPAYMSSPPRFM NKSSKYLISSQDFWPSGPAYMSSPPRFMNK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |