Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0224200_circ_g.2 |
| ID in PlantcircBase | osa_circ_018610 |
| Alias | Os_ciR2993 |
| Organism | Oryza sativa |
| Position | chr3: 6514853-6515740 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0224200 |
| Parent gene annotation |
B-type response regulator, Cytokinin signaling (Os03t0224200-01) ;B-type response regulator, Cytokinin signaling (Os03t0224200-02 );Similar to response regulator 8. (Os03t0224200-03) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0224200-03:1 Os03t0224200-02:3 Os03t0224200-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.293599615 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6515722-6514913(+) 6514889-6514882(+) |
| Potential amino acid sequence |
MSPAICSDNLFSGYKSINYAAREQAWF*(+) MLRENRRGFDVIISDVHMPDMDGFRLLELVGLEMDLPVIMMSADSRTDIVMKGIKHGACDYLIK PVRMEELKNIWQHVIRKKFNENKEHEHSGSLDDTDRTRPTNNDNEYASSANDGAEGSWKSQKKK RDKDDDDGELESGDPSSTSKKPRVVWSVELHQQFVNAVNHLGIDKAVPKKILELMNVPGLTREN VASHLQRQLVLRLQEH*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |