Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0414000_circ_g.3 |
| ID in PlantcircBase | osa_circ_009215 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 12636303-12636564 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0414000 |
| Parent gene annotation |
eIF4-gamma/eIF5/eIF2-epsilon domain containing protein. (Os11t04 14000-01);Similar to predicted protein. (Os11t0414000-02) |
| Parent gene strand | - |
| Alternative splicing | Os11g0414000_circ_g.2 Os11g0414000_circ_g.4 Os11g0414000_circ_g.5 Os11g0414000_circ_g.6 |
| Support reads | 5 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0414000-02:1 Os11t0414000-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.481506966 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12636383-12636314(+) |
| Potential amino acid sequence |
MRTTSISGNLASFTCCLTASVTSDISASSLIIVVSVNFISLSLTSNIFFSLYSTRLVRPSLLPK C*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |